Research Cart

Your lab queue is empty.

Free Shipping$250 remaining

Subtotal$0.00

Shipping and taxes calculated at checkout.

Back to Catalog

GH Secretagogues

IGF-1LR3

≥99.1% HPLC Verified Purity

CAS Number143045-27-6

Molecular Weight9111.6 Da

Molecular FormulaC₄₀₀H₆₂₅N₁₁₁O₁₁₅S₆

Storage−20°C · Lyophilized

$60.00/ vial

Backorder · Ships in 14–21 days

RESEARCH USE ONLY: This compound is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease. Not evaluated by the FDA. Must be 21+ to purchase.

What is IGF-1 LR3?

IGF-1 LR3 is a long arginine 3 IGF-1, a recombinant IGF-1 analog with an N-terminal extension and Arg3 substitution. With the molecular formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₆ and a molecular weight of 9111.6 g/mol (CAS: 143045-27-6), it structurally mimics endogenous peptides while extending its sequence.

Amino Acid Sequence:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEHK

Classification: Long ArginineIGF-1 ReceptorPI3K/AKT Signaling Pathway

Specifications

CAS Number	143045-27-6
Molecular Formula	C400H625N111O115S6
Molecular Weight	9111.6 Da
Purity	≥99.1% (HPLC verified)
Form	Lyophilized powder
Storage	−20°C · Lyophilized

Published Research

White et al. (2021) investigated IGF-1 LR3's binding affinity and receptor interactions in vitro (PMID: 33938236).

PMID: 33938236

Pesall et al. (2001) investigated IGF-1 LR3's binding affinity and receptor interactions in vitro (PMID: 11469659).

PMID: 11469659

Mechanism of Action

IGF-1 Receptor

Receptor interaction

Published research demonstrates IGF-1 LR3 modulates targeted signaling cascades within cell tissue models (PMID: 33938236).

PI3K/AKT Signaling Pathway

Signaling cascade

In cellular environments, IGF-1 LR3 exhibits selective binding and corresponding pathway activation (PMID: 11469659).

Storage & Handling

Temperature:-20°C for long-term storage

Light Sensitivity:Protect from direct light

Stability Duration:Stable for 24 months when stored properly

Research-grade sequence verification via standard assays.

Related Compounds

BPC-157 TB-500 CJC-1295 NO DAC

Research Use Only

All compounds are sold strictly for laboratory research use. Not for human or animal consumption. These products are not drugs, supplements, or food. Statements have not been evaluated by the FDA. Must be 21+ to purchase. This compound is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.

Research Catalog

High-purity, structurally verified peptide sequences for advanced laboratory and pre-clinical applications.